Recombinant Human Mucin-5AC (MUC5A), partial
This Recombinant Human Mucin-5AC (MUC5A), partial spans the amino acid sequence from region 4919-5103. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Mucin-5AC; MUC-5AC; Gastric mucin; Major airway glycoprotein; Mucin-5 subtype AC, tracheobronchial; Tracheobronchial mucin; TBM; MUC5AC MUC5
UniProt
P98088
Expression Region
4919-5103
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
CVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIVPVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATIPELGVQVMFSGLIFSVEVPFSKFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
127093-HRP 100 µL
GADD45A (Growth Arrest And DNA-damage-inducible Protein GADD45 alpha, DNA-damage-inducible Transcript 1, DDIT-1, DDIT1, GADD45) (HRP)
Sign In for Pricing
View Details VAng-Yyj2727-50gEcoli 50 µg (E. coli)
Recombinant Mycobacterium Avium pyrH Protein (aa 1-265)
Sign In for Pricing
View Details ARP52757_P050 100 µL
CCDC52 antibody - middle region (ARP52757_P050)
Sign In for Pricing
View Details