Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heat shock factor protein 1 (HSF1)

This Recombinant Human Heat shock factor protein 1 (HSF1) spans the amino acid sequence from region 1-529. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Heat shock factor protein 1; HSF 1; Heat shock transcription factor 1; HSTF 1; HSF1 HSTF1

UniProt

Q00613

Expression Region

1-529

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREB1 Antibody
KC-10483-01 50 μL

CREB1 Antibody

Sign In for Pricing
View Details
CREB1 Antibody
KC-10483-02 100 µL

CREB1 Antibody

Sign In for Pricing
View Details
CREB1 Antibody
KC-10483-03 1 mL

CREB1 Antibody

Sign In for Pricing
View Details
Mono(3-hydroxybutyl)phthalate-d4
TRC-M546302-25MG 25 mg

Mono(3-hydroxybutyl)phthalate-d4

Sign In for Pricing
View Details
Mouse Col9a3 activation kit by CRISPRa
GA200828 1 Kit

Mouse Col9a3 activation kit by CRISPRa

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) (NM_001127707) Human Recombinant Protein
TP325664M 100 µg

alpha 1 Antitrypsin (SERPINA1) (NM_001127707) Human Recombinant Protein

Sign In for Pricing
View Details