Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 (PLCB2), partial

This Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 (PLCB2), partial spans the amino acid sequence from region 312-463. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2; EC 3.1.4.11; Phosphoinositide phospholipase C-beta-2; Phospholipase C-beta-2; PLC-beta-2; PLCB2

UniProt

Q00722

Expression Region

312-463

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDCWKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKMAEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Drosophila melanogaster (Fruit fly) Prosalpha3T Polyclonal Antibody
MBS9014352 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) Prosalpha3T Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl 3- (tert-butylamino) propanoate
BAA46298-01 0.5 g

Ethyl 3- (tert-butylamino) propanoate

Sign In for Pricing
View Details
Ethyl 3- (tert-butylamino) propanoate
BAA46298-02 5 g

Ethyl 3- (tert-butylamino) propanoate

Sign In for Pricing
View Details
AP1B1 (NM_001166019) Human Untagged Clone
SC327674 10 µg

AP1B1 (NM_001166019) Human Untagged Clone

Sign In for Pricing
View Details
NHLRC3 Protein Lysate
OCOA16188-20UG 20 µg

NHLRC3 Protein Lysate

Sign In for Pricing
View Details
DNA pol ι Polyclonal Antibody
ABP53615-01 30 µL

DNA pol ι Polyclonal Antibody

Sign In for Pricing
View Details