Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial

This Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial spans the amino acid sequence from region 124-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 5; Polyposis locus protein 1; Protein TB2; REEP5 C5orf18 DP1 TB2

UniProt

Q00765

Expression Region

124-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SuLT1C2 (NM_176825) Human Tagged ORF Clone
RG221503 10 µg

SuLT1C2 (NM_176825) Human Tagged ORF Clone

Sign In for Pricing
View Details
HSC 70 (h2) -PR
sc-44263-PR 10 µM - 20 µL

HSC 70 (h2) -PR

Sign In for Pricing
View Details
Mouse Monoclonal Adenylate Kinase 1 Antibody (OTI4A1) [DyLight 650]
NBP2-70123C 0.1 mL

Mouse Monoclonal Adenylate Kinase 1 Antibody (OTI4A1) [DyLight 650]

Sign In for Pricing
View Details
Diluted McIlvaine Buffer Solution (pH 6.0) (10x)
06371-96 20 L

Diluted McIlvaine Buffer Solution (pH 6.0) (10x)

Sign In for Pricing
View Details
NT5C AAV Vector (Mouse) (CMV)
32217104 1 µg

NT5C AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
USP22 Rabbit mAb Antibody
orb1950556-01 50 µL

USP22 Rabbit mAb Antibody

Sign In for Pricing
View Details