Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial

This Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial spans the amino acid sequence from region 124-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 5; Polyposis locus protein 1; Protein TB2; REEP5 C5orf18 DP1 TB2

UniProt

Q00765

Expression Region

124-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 5 + 6 + 18 Rabbit mAb
F2909-100uL 100 µL

Cytokeratin 5 + 6 + 18 Rabbit mAb

Sign In for Pricing
View Details
Ran-binding protein 3-like (RANBP3L) Antibody (FITC)
abx340704-01 20 µg

Ran-binding protein 3-like (RANBP3L) Antibody (FITC)

Sign In for Pricing
View Details
Ran-binding protein 3-like (RANBP3L) Antibody (FITC)
abx340704-02 50 µg

Ran-binding protein 3-like (RANBP3L) Antibody (FITC)

Sign In for Pricing
View Details
Ran-binding protein 3-like (RANBP3L) Antibody (FITC)
abx340704-03 100 µg

Ran-binding protein 3-like (RANBP3L) Antibody (FITC)

Sign In for Pricing
View Details
Ran-binding protein 3-like (RANBP3L) Antibody (FITC)
abx340704-04 200 µg

Ran-binding protein 3-like (RANBP3L) Antibody (FITC)

Sign In for Pricing
View Details
Ran-binding protein 3-like (RANBP3L) Antibody (FITC)
abx340704-05 1 mg

Ran-binding protein 3-like (RANBP3L) Antibody (FITC)

Sign In for Pricing
View Details