Recombinant Human Myosin-binding protein C, slow-type (MYPC1), partial
This Recombinant Human Myosin-binding protein C, slow-type (MYPC1), partial spans the amino acid sequence from region 722-833. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Myosin-binding protein C, slow-type; Slow MyBP-C; C-protein, skeletal muscle slow isoform; MYBPC1 MYBPCS
UniProt
Q00872
Expression Region
722-833
Origin
Homo sapiens (Human)
Field of Research
Musculoskeletal & Connective Tissue Research
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
TLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741557-500 1x 500 µL
CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040451-500 1x 500 µL
HER-2 / CD340 (HRB2/451), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-E891990-250MG 250 mg
(2-Ethoxy-ethyl)-2-piperidin-4-yl-1H-benzimidazole Dihydrochloride
Sign In for Pricing
View Details ![SEC14L1 Mouse Monoclonal Antibody [Clone ID: OTI3A6]](https://cdn.genprice.uk/products/937/68dd18ba061270361e90848c/imageurl/cf808987.webp)
CF808987 100 µg
SEC14L1 Mouse Monoclonal Antibody [Clone ID: OTI3A6]
Sign In for Pricing
View Details