Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial

This Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial spans the amino acid sequence from region 260-338. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium channel protein type 7 subunit alpha; Atypical sodium channel Nav2.1; Nax channel; Sodium channel protein type VII subunit alpha; SCN7A SCN6A

UniProt

Q01118

Expression Region

260-338

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGNLKHKCFRWPQENENETLHNRTGNPYYIRETENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chlorobaculum parvum Leucine--tRNA ligase (leuS), partial
MBS1062058 Inquire

Recombinant Chlorobaculum parvum Leucine--tRNA ligase (leuS), partial

Sign In for Pricing
View Details
Recombinant Chicken Ubiquitin-associated domain-containing protein 2 (UBAC2)
MBS7032474-01 0.02 mg

Recombinant Chicken Ubiquitin-associated domain-containing protein 2 (UBAC2)

Sign In for Pricing
View Details
Recombinant Chicken Ubiquitin-associated domain-containing protein 2 (UBAC2)
MBS7032474-02 0.1 mg

Recombinant Chicken Ubiquitin-associated domain-containing protein 2 (UBAC2)

Sign In for Pricing
View Details
Recombinant Chicken Ubiquitin-associated domain-containing protein 2 (UBAC2)
MBS7032474-03 5x 0.1 mg

Recombinant Chicken Ubiquitin-associated domain-containing protein 2 (UBAC2)

Sign In for Pricing
View Details
Immunology/Inflammation related Antibody
orb2567359-01 5 mg

Immunology/Inflammation related Antibody

Sign In for Pricing
View Details
Immunology/Inflammation related Antibody
orb2567359-02 1 mg

Immunology/Inflammation related Antibody

Sign In for Pricing
View Details