Recombinant Human Amyloid-beta A4 precursor protein-binding family A member 1 (APBA1), partial
This Recombinant Human Amyloid-beta A4 precursor protein-binding family A member 1 (APBA1), partial spans the amino acid sequence from region 457-643. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Amyloid-beta A4 precursor protein-binding family A member 1; Adapter protein X11alpha; Neuron-specific X11 protein; Neuronal Munc18-1-interacting protein 1; Mint-1; APBA1 MINT1 X11
UniProt
Q02410
Expression Region
457-643
Origin
Homo sapiens (Human)
Field of Research
Neuroscience
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
DGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYND
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7097274 Inquire
Recombinant Agrobacterium tumefaciens UPF0391 membrane protein Atu4467 (Atu4467), partial
Sign In for Pricing
View Details 
