Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial

This Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial spans the amino acid sequence from region 1-57. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon-induced transmembrane protein 3; Dispanin subfamily A member 2b; DSPA2b; Interferon-inducible protein 1-8U; IFITM3

UniProt

Q01628

Expression Region

1-57

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEBOV VP40 Recombinant Protein (N-His)
VK783032-01 50 µg

SEBOV VP40 Recombinant Protein (N-His)

Sign In for Pricing
View Details
SEBOV VP40 Recombinant Protein (N-His)
VK783032-02 100 µg

SEBOV VP40 Recombinant Protein (N-His)

Sign In for Pricing
View Details
SEBOV VP40 Recombinant Protein (N-His)
VK783032-03 1 mg

SEBOV VP40 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Aip sgRNA CRISPR Lentivector (Rat) (Target 3)
K6269304 1.0 µg DNA

Aip sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Anti-DIAPH3 antibody
STJ71360 100 µg

Anti-DIAPH3 antibody

Sign In for Pricing
View Details
Caspase 3 (CASP3) (NM_032991) Human Tagged ORF Clone Lentiviral Particle
RC204444L3V 200 µL

Caspase 3 (CASP3) (NM_032991) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details