Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial

This Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial spans the amino acid sequence from region 1-57. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon-induced transmembrane protein 3; Dispanin subfamily A member 2b; DSPA2b; Interferon-inducible protein 1-8U; IFITM3

UniProt

Q01628

Expression Region

1-57

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAQ Protein Vector (Mouse) (pPM-C-His)
PV185229 500 ng

GNAQ Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human RPS17 Protein
E30P70142B 50 µg

Recombinant Human RPS17 Protein

Sign In for Pricing
View Details
anti-SOX15
YF-PA24753 50 ul

anti-SOX15

Sign In for Pricing
View Details
PHC1 (Polyhomeotic-like Protein 1, hPH1, Early Development Regulatory Protein 1, EDR1, PH1) (MaxLight 490)
MBS6389268-01 0.1 mL

PHC1 (Polyhomeotic-like Protein 1, hPH1, Early Development Regulatory Protein 1, EDR1, PH1) (MaxLight 490)

Sign In for Pricing
View Details
PHC1 (Polyhomeotic-like Protein 1, hPH1, Early Development Regulatory Protein 1, EDR1, PH1) (MaxLight 490)
MBS6389268-02 5x 0.1 mL

PHC1 (Polyhomeotic-like Protein 1, hPH1, Early Development Regulatory Protein 1, EDR1, PH1) (MaxLight 490)

Sign In for Pricing
View Details
Caprisil C18-P HPLC Column, 5 µm, 100 Å, CD553-C18-P x 200 mm
CD553-C18-P 5 µm

Caprisil C18-P HPLC Column, 5 µm, 100 Å, CD553-C18-P x 200 mm

Sign In for Pricing
View Details