Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human OTU domain-containing protein 4 (OTUD4), partial

This Recombinant Human OTU domain-containing protein 4 (OTUD4), partial spans the amino acid sequence from region 34-155. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OTU domain-containing protein 4; EC 3.4.19.12; HIV-1-induced protein HIN-1; OTUD4 HIN-1 KIAA1046

UniProt

Q01804

Expression Region

34-155

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGNHYDIVYPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,5-Di-tert-butylphenol
TRC-D679065-50MG 50 mg

3,5-Di-tert-butylphenol

Sign In for Pricing
View Details
Recombinant Human NKp30/NCR3 protein (His tag)
PDMH100415-01 20 µg

Recombinant Human NKp30/NCR3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human NKp30/NCR3 protein (His tag)
PDMH100415-02 100 µg

Recombinant Human NKp30/NCR3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human NKp30/NCR3 protein (His tag)
PDMH100415-03 500 µg

Recombinant Human NKp30/NCR3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human NKp30/NCR3 protein (His tag)
PDMH100415-04 1 mg

Recombinant Human NKp30/NCR3 protein (His tag)

Sign In for Pricing
View Details
Human VPS25 activation kit by CRISPRa
GA113507 1 Kit

Human VPS25 activation kit by CRISPRa

Sign In for Pricing
View Details