Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human OTU domain-containing protein 4 (OTUD4), partial

This Recombinant Human OTU domain-containing protein 4 (OTUD4), partial spans the amino acid sequence from region 34-155. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OTU domain-containing protein 4; EC 3.4.19.12; HIV-1-induced protein HIN-1; OTUD4 HIN-1 KIAA1046

UniProt

Q01804

Expression Region

34-155

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGNHYDIVYPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cox7a2 Mouse Gene Knockout Kit (CRISPR)
KN503730 1 Kit

Cox7a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-(3-Butyn-1-yl)-3H-diazirine-3-ethanamine
TRC-B809775-5MG 5 mg

3-(3-Butyn-1-yl)-3H-diazirine-3-ethanamine

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS644597 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Pyraclostrobin-d6
TRC-P840402-1MG 1 mg

Pyraclostrobin-d6

Sign In for Pricing
View Details
Ferritin Heavy Chain Recombinant Rabbit Monoclonal Antibody [JM22-36]
ET1705-55 100 µL

Ferritin Heavy Chain Recombinant Rabbit Monoclonal Antibody [JM22-36]

Sign In for Pricing
View Details
FAM124B (NM_024785) Human Over-expression Lysate
LY403030 100 µg

FAM124B (NM_024785) Human Over-expression Lysate

Sign In for Pricing
View Details