Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human OTU domain-containing protein 4 (OTUD4), partial

This Recombinant Human OTU domain-containing protein 4 (OTUD4), partial spans the amino acid sequence from region 34-155. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OTU domain-containing protein 4; EC 3.4.19.12; HIV-1-induced protein HIN-1; OTUD4 HIN-1 KIAA1046

UniProt

Q01804

Expression Region

34-155

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGNHYDIVYPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Myometrium
CR559598 5 µg

Tissue Total RNA, Myometrium

Sign In for Pricing
View Details
4-Nitrobenzyl Chloroformate
TRC-N493645-100G 100 g

4-Nitrobenzyl Chloroformate

Sign In for Pricing
View Details
2,2-Difluoroethylamine-d2 Hydrochloride
TRC-D445816-500MG 500 mg

2,2-Difluoroethylamine-d2 Hydrochloride

Sign In for Pricing
View Details
Total Carbohydrate Microplate Assay Kit
RDSM184 100 Assays

Total Carbohydrate Microplate Assay Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS509661 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
ALR (GFER) (C-term) Rabbit Polyclonal Antibody
AP51820PU-N 400 µL

ALR (GFER) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details