Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA-binding protein EWS (EWS)

This Recombinant Human RNA-binding protein EWS (EWS) spans the amino acid sequence from region 1-656. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNA-binding protein EWS; EWS oncogene; Ewing sarcoma breakpoint region 1 protein; EWSR1 EWS

UniProt

Q01844

Expression Region

1-656

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-AKAP13/AKAP-Lbc Antibody, Affinity Purified
MBS3901899-01 0.01 mg

Rabbit anti-AKAP13/AKAP-Lbc Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-AKAP13/AKAP-Lbc Antibody, Affinity Purified
MBS3901899-02 0.1 mg

Rabbit anti-AKAP13/AKAP-Lbc Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-AKAP13/AKAP-Lbc Antibody, Affinity Purified
MBS3901899-03 5x 0.01 mg

Rabbit anti-AKAP13/AKAP-Lbc Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-AKAP13/AKAP-Lbc Antibody, Affinity Purified
MBS3901899-04 5x 0.1 mg

Rabbit anti-AKAP13/AKAP-Lbc Antibody, Affinity Purified

Sign In for Pricing
View Details
Recombinant Takifugu rubripes 5-hydroxytryptamine receptor 1A-alpha (htr1aa)
MBS1122661 Inquire

Recombinant Takifugu rubripes 5-hydroxytryptamine receptor 1A-alpha (htr1aa)

Sign In for Pricing
View Details
Cytoplasmic polyadenylation element-binding protein 3 (CPEB3) Mouse ELISA Kit
C7897 96 Tests

Cytoplasmic polyadenylation element-binding protein 3 (CPEB3) Mouse ELISA Kit

Sign In for Pricing
View Details