Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human POU domain, class 4, transcription factor 1 (PO4F1)

This Recombinant Human POU domain, class 4, transcription factor 1 (PO4F1) spans the amino acid sequence from region 1-419. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

POU domain, class 4, transcription factor 1; Brain-specific homeobox/POU domain protein 3A; Brain-3A; Brn-3A; Homeobox/POU domain protein RDC-1; Oct-T1; POU4F1 BRN3A RDC1

UniProt

Q01851

Expression Region

1-419

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human epidemic hemorrhagic fever IgM (EHF IgM) ELISA Kit
QY-E02253 96 Tests

Human epidemic hemorrhagic fever IgM (EHF IgM) ELISA Kit

Sign In for Pricing
View Details
CD59 Over-expression Lysate Product
GWB-F1F931 0.1 mg

CD59 Over-expression Lysate Product

Sign In for Pricing
View Details
RHOU Polyclonal Antibody
MBS2543025-01 0.02 mL

RHOU Polyclonal Antibody

Sign In for Pricing
View Details
RHOU Polyclonal Antibody
MBS2543025-02 0.06 mL

RHOU Polyclonal Antibody

Sign In for Pricing
View Details
RHOU Polyclonal Antibody
MBS2543025-03 0.12 mL

RHOU Polyclonal Antibody

Sign In for Pricing
View Details
RHOU Polyclonal Antibody
MBS2543025-04 0.2 mL

RHOU Polyclonal Antibody

Sign In for Pricing
View Details