Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial

This Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial spans the amino acid sequence from region 172-236. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent dopamine transporter; DA transporter; DAT; Solute carrier family 6 member 3; SLC6A3 DAT1

UniProt

Q01959

Expression Region

172-236

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-(2,6-Dichloroanilino)-3-thiopheneacetonitrile-13C
TRC-D431812-1MG 1 mg

4-(2,6-Dichloroanilino)-3-thiopheneacetonitrile-13C

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (HMPV), Biotin conjugate, 0.1mg/mL
BNCB0954-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (HMPV), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/3121R), CF405S conjugate, 0.1mg/mL
BNC043121-100 1x 100 µL

Aurora B (Proliferation Marker) (AURKB/3121R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3102), CF568 conjugate, 0.1mg/mL
BNC683102-100 1x 100 µL

Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3102), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, multi (C11), CF405S conjugate, 0.1mg/mL
BNC040393-500 1x 500 µL

Cytokeratin, multi (C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Acetoxysuccinimide
TRC-A164295-25G 25 g

N-Acetoxysuccinimide

Sign In for Pricing
View Details