Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial

This Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial spans the amino acid sequence from region 172-236. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent dopamine transporter; DA transporter; DAT; Solute carrier family 6 member 3; SLC6A3 DAT1

UniProt

Q01959

Expression Region

172-236

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARSI Antibody
8C14571-AAT 50 µg

ARSI Antibody

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/2403), CF640R conjugate, 0.1mg/mL
BNC402403-500 1x 500 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/2403), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon: right
CB513444 1 Block

Frozen Tissue Blocks, Colon: right

Sign In for Pricing
View Details
Ep-CAM / CD326 (Rat) (GZ-20), CF640R conjugate, 0.1mg/mL
BNC400382-500 1x 500 µL

Ep-CAM / CD326 (Rat) (GZ-20), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ASPA (NM_001128085) Human Recombinant Protein
TP325443 20 µg

ASPA (NM_001128085) Human Recombinant Protein

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (DT101 + BC199), 1mg/mL
BNUM0737-50 1x 50 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (DT101 + BC199), 1mg/mL

Sign In for Pricing
View Details