Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial

This Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial spans the amino acid sequence from region 50-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 6A2, mitochondrial; Cytochrome c oxidase polypeptide VIa-heart; COXVIAH; Cytochrome c oxidase subunit VIA-muscle; COX VIa-M; COX6A2 COX6A COX6AH

UniProt

Q02221

Expression Region

50-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF740 conjugate, 0.1mg/mL
BNC740322-500 1x 500 µL

CD3e (RIV9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-500 1x 500 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
BNC700391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10), CF660R conjugate, 0.1mg/mL
BNC610640-100 1x 100 µL

CD34 (QBEnd/10), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF488A conjugate, 0.1mg/mL
BNC882217-500 1x 500 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF647 conjugate, 0.1mg/mL
BNC471967-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details