Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial

This Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial spans the amino acid sequence from region 50-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 6A2, mitochondrial; Cytochrome c oxidase polypeptide VIa-heart; COXVIAH; Cytochrome c oxidase subunit VIA-muscle; COX VIa-M; COX6A2 COX6A COX6AH

UniProt

Q02221

Expression Region

50-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAS1R2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-9599R-BF647 100 µL

TAS1R2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
IFIH1 Recombinant Protein
OPCD04108-200UG 200 µg

IFIH1 Recombinant Protein

Sign In for Pricing
View Details
Cytochrome P450 2C9 (CYP2C9) (NM_000771) Human Over-expression Lysate
E45H20029-2 20 µg

Cytochrome P450 2C9 (CYP2C9) (NM_000771) Human Over-expression Lysate

Sign In for Pricing
View Details
Guinea Pig Arginyl tRNA protein transferase 1 (ATE1) ELISA Kit
GTR10328567 96 Well

Guinea Pig Arginyl tRNA protein transferase 1 (ATE1) ELISA Kit

Sign In for Pricing
View Details
Anti-Cytokeratin 7/KRT7 Antibody, Rabbit Polyclonal
MBS8100237-01 0.1 mL

Anti-Cytokeratin 7/KRT7 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Cytokeratin 7/KRT7 Antibody, Rabbit Polyclonal
MBS8100237-02 5x 0.1 mL

Anti-Cytokeratin 7/KRT7 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details