Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Contactin-2 (CNTN2), partial

This Recombinant Human Contactin-2 (CNTN2), partial spans the amino acid sequence from region 610-708. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Contactin-2; Axonal glycoprotein TAG-1; Axonin-1; Transient axonal glycoprotein 1; TAX-1; CNTN2 AXT TAG1 TAX1

UniProt

Q02246

Expression Region

610-708

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
RPU53271-01 50 µg

Recombinant Human Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
RPU53271-02 100 µg

Recombinant Human Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
RPU53271-03 1 mg

Recombinant Human Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details
Mouse Ferritin, Light Polypeptide (FTL) ELISA Kit
RD-FTL-Mu-96Tests 96 Tests

Mouse Ferritin, Light Polypeptide (FTL) ELISA Kit

Sign In for Pricing
View Details
Anti Plasmodium LDH Mab
111638 100 µg

Anti Plasmodium LDH Mab

Sign In for Pricing
View Details
RplQ Antibody
orb826369 2 mg

RplQ Antibody

Sign In for Pricing
View Details