Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Contactin-2 (CNTN2), partial

This Recombinant Human Contactin-2 (CNTN2), partial spans the amino acid sequence from region 610-708. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Contactin-2; Axonal glycoprotein TAG-1; Axonin-1; Transient axonal glycoprotein 1; TAX-1; CNTN2 AXT TAG1 TAX1

UniProt

Q02246

Expression Region

610-708

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amine Gold Nanorods (amine-PEG5000-SH), 15nm diameter, absorption max 700nm
GRA5K-15-700-25 0.5 mL

Amine Gold Nanorods (amine-PEG5000-SH), 15nm diameter, absorption max 700nm

Sign In for Pricing
View Details
Growth Arrest And DNA Damage-Inducible Protein GADD45 Alpha (GADD45A) Antibody
abx377988-01 50 µg

Growth Arrest And DNA Damage-Inducible Protein GADD45 Alpha (GADD45A) Antibody

Sign In for Pricing
View Details
Growth Arrest And DNA Damage-Inducible Protein GADD45 Alpha (GADD45A) Antibody
abx377988-02 100 µg

Growth Arrest And DNA Damage-Inducible Protein GADD45 Alpha (GADD45A) Antibody

Sign In for Pricing
View Details
Cntn6 3'UTR Luciferase Stable Cell Line
TU104136 1.0 mL

Cntn6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant IBV (B/Massachusetts/03/2010) Hemagglutinin Protein (HA1 Subunit) [His]
DAG-H10525 100 µg

Recombinant IBV (B/Massachusetts/03/2010) Hemagglutinin Protein (HA1 Subunit) [His]

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)
MBS2038102-01 0.1 mL

HRP-Linked Polyclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)

Sign In for Pricing
View Details