Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H1.1 (H11)

This Recombinant Human Histone H1.1 (H11) spans the amino acid sequence from region 2-215. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H1.1; Histone H1a; H1-1 H1F1 HIST1H1A

UniProt

Q02539

Expression Region

2-215

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP Anti-Human CD40 Antibody[3A8]
E-AB-F1037F-01 20 Tests

PerCP Anti-Human CD40 Antibody[3A8]

Sign In for Pricing
View Details
PerCP Anti-Human CD40 Antibody[3A8]
E-AB-F1037F-02 100 Tests

PerCP Anti-Human CD40 Antibody[3A8]

Sign In for Pricing
View Details
PerCP Anti-Human CD40 Antibody[3A8]
E-AB-F1037F-03 2x 100 Tests

PerCP Anti-Human CD40 Antibody[3A8]

Sign In for Pricing
View Details
Azobenzene-4,4'-dicarboxylic Acid
TRC-A931008-10MG 10 mg

Azobenzene-4,4'-dicarboxylic Acid

Sign In for Pricing
View Details
Natural Convection Oven BONC-101
BONC-101 1 Unit

Natural Convection Oven BONC-101

Sign In for Pricing
View Details
Molecular Sieves, 3A, Powder
TRC-M489003-500G 500 g

Molecular Sieves, 3A, Powder

Sign In for Pricing
View Details