Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H1.1 (H11)

This Recombinant Human Histone H1.1 (H11) spans the amino acid sequence from region 2-215. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H1.1; Histone H1a; H1-1 H1F1 HIST1H1A

UniProt

Q02539

Expression Region

2-215

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc148 Mouse Gene Knockout Kit (CRISPR)
KN502666 1 Kit

Ccdc148 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hydrazine Sulfate-15N2
TRC-H718002-50MG 50 mg

Hydrazine Sulfate-15N2

Sign In for Pricing
View Details
EGFR Human Gene Knockout Kit (CRISPR)
KN414877 1 Kit

EGFR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cixutumumab Biosimilar - Research Grade
ICH5144-20mg 20 mg

Cixutumumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Recombinant PTGDS Antibody
RC-3078-01 50 μL

Recombinant PTGDS Antibody

Sign In for Pricing
View Details
Recombinant PTGDS Antibody
RC-3078-02 100 µL

Recombinant PTGDS Antibody

Sign In for Pricing
View Details