Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth hormone-releasing hormone receptor (GHRHR), partial

This Recombinant Human Growth hormone-releasing hormone receptor (GHRHR), partial spans the amino acid sequence from region 23-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Growth hormone-releasing hormone receptor; GHRH receptor; Growth hormone-releasing factor receptor; GRF receptor; GRFR; GHRHR

UniProt

Q02643

Expression Region

23-130

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFSTVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICMT Rabbit pAb, Pacific Blue conjugated
orb2869474 100 µL

ICMT Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
PPP4C Rabbit pAb, BF700 conjugated
orb2874062 100 µL

PPP4C Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Mouse Monoclonal TEM7/PLXDC1 Antibody (197C193 (IM193)) [DyLight 350]
NB100-56557UV 0.1 mL

Mouse Monoclonal TEM7/PLXDC1 Antibody (197C193 (IM193)) [DyLight 350]

Sign In for Pricing
View Details
Flotillin 1 Rabbit Polyclonal Antibody
APRab00021-01 20 µL

Flotillin 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Flotillin 1 Rabbit Polyclonal Antibody
APRab00021-02 50 µL

Flotillin 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Flotillin 1 Rabbit Polyclonal Antibody
APRab00021-03 100 µL

Flotillin 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details