Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone-lysine N-methyltransferase MECOM (MECOM), partial

This Recombinant Human Histone-lysine N-methyltransferase MECOM (MECOM), partial spans the amino acid sequence from region 78-190. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone-lysine N-methyltransferase MECOM; EC 2.1.1.367; Ecotropic virus integration site 1 protein homolog; EVI-1; MDS1 and EVI1 complex locus protein; Myelodysplasia syndrome 1 protein; Myelodysplasia syndrome-associated protein 1; MECOM EVI1 MDS1 PRDM3

UniProt

Q03112

Expression Region

78-190

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin; Pharmacology & Drug Discovery; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CHMP3 Protein
E30P8427 20 µg

Recombinant Human CHMP3 Protein

Sign In for Pricing
View Details
PFKFB1 Antibody
MBS9604561-01 0.1 mL

PFKFB1 Antibody

Sign In for Pricing
View Details
PFKFB1 Antibody
MBS9604561-02 0.2 mL

PFKFB1 Antibody

Sign In for Pricing
View Details
PFKFB1 Antibody
MBS9604561-03 5x 0.2 mL

PFKFB1 Antibody

Sign In for Pricing
View Details
Human Transforming Growth Factor Alpha (TGFa) ELISA Kit
RD-TGFa-Hu-96Tests 96 Tests

Human Transforming Growth Factor Alpha (TGFa) ELISA Kit

Sign In for Pricing
View Details
Hsa-miR-1469 miRNA Mimic
CMH0832-01 5 nmol

Hsa-miR-1469 miRNA Mimic

Sign In for Pricing
View Details