Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (X) chain (COAA1)

This Recombinant Human Collagen alpha-1 (X) chain (COAA1) spans the amino acid sequence from region 19-680. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collagen alpha-1 (X; chain COL10A1

UniProt

Q03692

Expression Region

19-680

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VFYAERYQMPTGIKGPLPNTKTQFFIPYTIKSKGIAVRGEQGTPGPPGPAGPRGHPGPSGPPGKPGYGSPGLQGEPGLPGPPGPSAVGKPGVPGLPGKPGERGPYGPKGDVGPAGLPGPRGPPGPPGIPGPAGISVPGKPGQQGPTGAPGPRGFPGEKGAPGVPGMNGQKGEMGYGAPGRPGERGLPGPQGPTGPSGPPGVGKRGENGVPGQPGIKGDRGFPGEMGPIGPPGPQGPPGERGPEGIGKPGAAGAPGQPGIPGTKGLPGAPGIAGPPGPPGFGKPGLPGLKGERGPAGLPGGPGAKGEQGPAGLPGKPGLTGPPGNMGPQGPKGIPGSHGLPGPKGETGPAGPAGYPGAKGERGSPGSDGKPGYPGKPGLDGPKGNPGLPGPKGDPGVGGPPGLPGPVGPAGAKGMPGHNGEAGPRGAPGIPGTRGPIGPPGIPGFPGSKGDPGSPGPPGPAGIATKGLNGPTGPPGPPGPRGHSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMG7 (NM_001174061) Human Over-expression Lysate
LY433658 100 µg

SMG7 (NM_001174061) Human Over-expression Lysate

Sign In for Pricing
View Details
CD66 (CEA) (C66/1009), Biotin conjugate, 0.1mg/mL
BNCB1009-500 1x 500 µL

CD66 (CEA) (C66/1009), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
hHR23b (RAD23B) (NM_002874) Human Over-expression Lysate
LC401012 20 µg

hHR23b (RAD23B) (NM_002874) Human Over-expression Lysate

Sign In for Pricing
View Details
Bisphenol A Monobenzyl Ether
TRC-B519535-5MG 5 mg

Bisphenol A Monobenzyl Ether

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS512333 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Usp6nl Mouse Gene Knockout Kit (CRISPR)
KN518813 1 Kit

Usp6nl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details