Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (X) chain (COAA1)

This Recombinant Human Collagen alpha-1 (X) chain (COAA1) spans the amino acid sequence from region 19-680. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collagen alpha-1 (X; chain COL10A1

UniProt

Q03692

Expression Region

19-680

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VFYAERYQMPTGIKGPLPNTKTQFFIPYTIKSKGIAVRGEQGTPGPPGPAGPRGHPGPSGPPGKPGYGSPGLQGEPGLPGPPGPSAVGKPGVPGLPGKPGERGPYGPKGDVGPAGLPGPRGPPGPPGIPGPAGISVPGKPGQQGPTGAPGPRGFPGEKGAPGVPGMNGQKGEMGYGAPGRPGERGLPGPQGPTGPSGPPGVGKRGENGVPGQPGIKGDRGFPGEMGPIGPPGPQGPPGERGPEGIGKPGAAGAPGQPGIPGTKGLPGAPGIAGPPGPPGFGKPGLPGLKGERGPAGLPGGPGAKGEQGPAGLPGKPGLTGPPGNMGPQGPKGIPGSHGLPGPKGETGPAGPAGYPGAKGERGSPGSDGKPGYPGKPGLDGPKGNPGLPGPKGDPGVGGPPGLPGPVGPAGAKGMPGHNGEAGPRGAPGIPGTRGPIGPPGIPGFPGSKGDPGSPGPPGPAGIATKGLNGPTGPPGPPGPRGHSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP1 antibody - C-terminal region (ARP59299_P050)
ARP59299_P050 100 µL

USP1 antibody - C-terminal region (ARP59299_P050)

Sign In for Pricing
View Details
DFNB43 CRISPR Knock Out 293T Cell Line (Human)
18097141 1x 10^6 Cells / 1.0 mL

DFNB43 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
SCAMP1 Antibody
23-789 100 µL

SCAMP1 Antibody

Sign In for Pricing
View Details
XIAP (D2Z8W) Rabbit Monoclonal Antibody
CST 14334T 20 µL

XIAP (D2Z8W) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Sertaconazole
C03409-1g 1 g

Sertaconazole

Sign In for Pricing
View Details
PMCA4 Rabbit Polyclonal Antibody (BF488)
orb2461436 100 µL

PMCA4 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details