Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human P protein (P), partial

This Recombinant Human P protein (P), partial spans the amino acid sequence from region 198-330. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P protein; Melanocyte-specific transporter protein; Pink-eyed dilution protein homolog; OCA2 D15S12 P

UniProt

Q04671

Expression Region

198-330

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PDQGKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQYLRGSVETQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 3-O-Allyl-4,6-O-benzylidene-2-O- (tetra-O-acetyl-alpha-D-mannopyranosyl) -alpha-D-mannopyranoside
MBS6067411-01 10 mg

Methyl 3-O-Allyl-4,6-O-benzylidene-2-O- (tetra-O-acetyl-alpha-D-mannopyranosyl) -alpha-D-mannopyranoside

Sign In for Pricing
View Details
Methyl 3-O-Allyl-4,6-O-benzylidene-2-O- (tetra-O-acetyl-alpha-D-mannopyranosyl) -alpha-D-mannopyranoside
MBS6067411-02 5x 10 mg

Methyl 3-O-Allyl-4,6-O-benzylidene-2-O- (tetra-O-acetyl-alpha-D-mannopyranosyl) -alpha-D-mannopyranoside

Sign In for Pricing
View Details
KCNA3 Antibody
orb671124-01 50 µg

KCNA3 Antibody

Sign In for Pricing
View Details
KCNA3 Antibody
orb671124-02 100 µg

KCNA3 Antibody

Sign In for Pricing
View Details
Hydroxysteroid Dehydrogenase, 17-beta 7, NT, (Hydroxysteroid (17-beta) Dehydrogenase 7, HSD17B7, 17-beta-hydroxysteroid Dehydrogenase 7, 17-beta-HSD 7, 3-Keto-steroid Reductase, Estradiol 17-beta-dehydrogenase 7, MGC12523, MGC75018, PRAP, SDR37C1, UNQ2563/PRO6243) (MaxLight 550) discontinued
H9117-83T-ML550 100 µL

Hydroxysteroid Dehydrogenase, 17-beta 7, NT, (Hydroxysteroid (17-beta) Dehydrogenase 7, HSD17B7, 17-beta-hydroxysteroid Dehydrogenase 7, 17-beta-HSD 7, 3-Keto-steroid Reductase, Estradiol 17-beta-dehydrogenase 7, MGC12523, MGC75018, PRAP, SDR37C1, UNQ2563/PRO6243) (MaxLight 550) discontinued

Sign In for Pricing
View Details
P47/Pleckstrin Polyclonal Antibody, PE-Cy7 Conjugated
bs-9902R-PE-Cy7 100 µL

P47/Pleckstrin Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details