Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human P protein (P), partial

This Recombinant Human P protein (P), partial spans the amino acid sequence from region 198-330. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P protein; Melanocyte-specific transporter protein; Pink-eyed dilution protein homolog; OCA2 D15S12 P

UniProt

Q04671

Expression Region

198-330

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PDQGKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQYLRGSVETQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-SREBP2 (Thr334) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-24294R-BF405 100 µL

Phospho-SREBP2 (Thr334) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Tough-Spots, small, silver labels for 0.5 mL tubes, 3/8 inch diameter, 1000/roll. For -196C to +80C.
9185-0018 1000 / Roll

Tough-Spots, small, silver labels for 0.5 mL tubes, 3/8 inch diameter, 1000/roll. For -196C to +80C.

Sign In for Pricing
View Details
Mitochondrial carnitine/acylcarnitine carrier protein CACL (SLC25A29) Mouse ELISA Kit
F0209 96 Tests

Mitochondrial carnitine/acylcarnitine carrier protein CACL (SLC25A29) Mouse ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal SIRP alpha/CD172a Antibody (602411) [PE/Cy5.5]
FAB4546PECY55 0.1 mL

Mouse Monoclonal SIRP alpha/CD172a Antibody (602411) [PE/Cy5.5]

Sign In for Pricing
View Details
HPV-L1 Protein (HPV)
P519725 100 µg

HPV-L1 Protein (HPV)

Sign In for Pricing
View Details
CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (APC)
124531-APC 100 µL

CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (APC)

Sign In for Pricing
View Details