Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human P protein (P), partial

This Recombinant Human P protein (P), partial spans the amino acid sequence from region 198-330. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P protein; Melanocyte-specific transporter protein; Pink-eyed dilution protein homolog; OCA2 D15S12 P

UniProt

Q04671

Expression Region

198-330

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PDQGKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQYLRGSVETQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bordetella pertussis fhaB/FHA Antibody
E55A13544 100 µg

Bordetella pertussis fhaB/FHA Antibody

Sign In for Pricing
View Details
PCNA Adenovirus (Mouse)
36209054 1.0 mL

PCNA Adenovirus (Mouse)

Sign In for Pricing
View Details
RAC-alpha serine/threonine-Protein kinase
331812-01 50 µg

RAC-alpha serine/threonine-Protein kinase

Sign In for Pricing
View Details
RAC-alpha serine/threonine-Protein kinase
331812-02 100 µg

RAC-alpha serine/threonine-Protein kinase

Sign In for Pricing
View Details
Antazoline phosphate
orb1705280 500 mg

Antazoline phosphate

Sign In for Pricing
View Details
A2BP1 Rabbit Polyclonal Antibody
orb100734-01 50 μL

A2BP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details