Recombinant Human Sialomucin core protein 24 (MUC24), partial
This Recombinant Human Sialomucin core protein 24 (MUC24), partial spans the amino acid sequence from region 24-162. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Sialomucin core protein 24; MUC-24; Endolyn; Multi-glycosylated core protein 24; MGC-24; MGC-24v; CD antigen CD164; CD164
UniProt
Q04900
Expression Region
24-162
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6211670-01 0.1 mL
GFRA1 (GDNF Family Receptor alpha-1, GDNF Receptor alpha-1, GDNFR-alpha-1, GFR-alpha-1, RET Ligand 1, TGF-beta-related Neurotrophic Factor Receptor 1, GDNFRA, RETL1, TRNR1) (MaxLight 550)
Sign In for Pricing
View Details MBS6211670-02 5x 0.1 mL
GFRA1 (GDNF Family Receptor alpha-1, GDNF Receptor alpha-1, GDNFR-alpha-1, GFR-alpha-1, RET Ligand 1, TGF-beta-related Neurotrophic Factor Receptor 1, GDNFRA, RETL1, TRNR1) (MaxLight 550)
Sign In for Pricing
View Details NBP2-70526PCP 0.1 mL
Mouse Monoclonal Cytochrome P450 2B6 Antibody (OTI3D5) [PerCP]
Sign In for Pricing
View Details 