Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuronal acetylcholine receptor subunit beta-3 (ACHB3), partial

This Recombinant Human Neuronal acetylcholine receptor subunit beta-3 (ACHB3), partial spans the amino acid sequence from region 22-237. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuronal acetylcholine receptor subunit beta-3 CHRNB3

UniProt

Q05901

Expression Region

22-237

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLPLFYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Socs1 3'UTR GFP Stable Cell Line
TU169451 1.0 mL

Socs1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
KIAA0999 (C-term) Rabbit pAb
E2611632 100 µL

KIAA0999 (C-term) Rabbit pAb

Sign In for Pricing
View Details
FOXK1 Protein Vector (Rat) (pPM-C-His)
PV268937 500 ng

FOXK1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal PKHD1 Antibody [Dylight 755]
BC110-60480IR 0.1 mL

Rabbit Polyclonal PKHD1 Antibody [Dylight 755]

Sign In for Pricing
View Details
Rabbit Polyclonal Cystatin SN Antibody [Alexa Fluor 594]
NBP2-99826AF594 0.1 mL

Rabbit Polyclonal Cystatin SN Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
SLC27A6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV623115 1.0 µg DNA

SLC27A6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details