Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha (P2R3A), partial

This Recombinant Human Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha (P2R3A), partial spans the amino acid sequence from region 758-793. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha; PP2A subunit B isoform PR72/PR130; PP2A subunit B isoform R3 isoform; PP2A subunit B isoforms B''-PR72/PR130; PP2A subunit B isoforms B72/B130; Serine/threonine-protein phosphatase 2A 72/130 kDa regulatory subunit B; PPP2R3A PPP2R3

UniProt

Q06190

Expression Region

758-793

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CPLYWKAPMFRAAGGEKTGFVTAQSFIAMWRKLLNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kaempferol 200mg
A10495-200 200 mg

Kaempferol 200mg

Sign In for Pricing
View Details
Fibcd1 ORF Vector (Mouse) (pORF)
20552014 1.0 µg DNA

Fibcd1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Mctp2 Pre-designed siRNA Set A
SI108272A 1 Each

Mouse Mctp2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
pEF1a-AMFR-3×FLAG-SV40-Neo Plasmid
PVT39293 2 µg

pEF1a-AMFR-3×FLAG-SV40-Neo Plasmid

Sign In for Pricing
View Details
ZNF549 Rabbit pAb
E45R27365N 50 ul

ZNF549 Rabbit pAb

Sign In for Pricing
View Details
Anti-CCAR2 Antibody (R2S37)
RHN83201 100 μg

Anti-CCAR2 Antibody (R2S37)

Sign In for Pricing
View Details