Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acetylcholine receptor subunit delta (ACHD), partial

This Recombinant Human Acetylcholine receptor subunit delta (ACHD), partial spans the amino acid sequence from region 22-245. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Acetylcholine receptor subunit delta CHRND ACHRD

UniProt

Q07001

Expression Region

22-245

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCNVLVYHYGFVYWLPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEITLSLKQDAKENRTYPVEWIIIDPEGFTENGEWEIVHRPARVNVDPRAPLDSPSRQDITFYLIIRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal N4BP2 Antibody
NBP2-59017-25ul 25 µL

Rabbit Polyclonal N4BP2 Antibody

Sign In for Pricing
View Details
BARHL1 (FITC)
556213-01 50 µg

BARHL1 (FITC)

Sign In for Pricing
View Details
BARHL1 (FITC)
556213-02 100 µg

BARHL1 (FITC)

Sign In for Pricing
View Details
Pitpnc1 Mouse shRNA Plasmid (Locus ID 71795)
TR514467 1 Kit

Pitpnc1 Mouse shRNA Plasmid (Locus ID 71795)

Sign In for Pricing
View Details
C6orf48 AAV Vector (Human) (CMV)
14651101 1 µg

C6orf48 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Lupeol trans-cinnamate
MBS5782536 Inquire

Lupeol trans-cinnamate

Sign In for Pricing
View Details