Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitotic-spindle organizing protein 1 (MZT1)

This Recombinant Human Mitotic-spindle organizing protein 1 (MZT1) spans the amino acid sequence from region 2-82. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitotic-spindle organizing protein 1; Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 1; MZT1 C13orf37 MOZART1

UniProt

Q08AG7

Expression Region

2-82

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ASSSGAGAAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAAENMTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HINT2 Recombinant Protein (Rat)
RP204578 100 µg

HINT2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
OPGL (Osteoprotegerin Ligand) BioAssayTM ELISA Kit (Rat) discontinued
357803-01 48 Tests

OPGL (Osteoprotegerin Ligand) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
OPGL (Osteoprotegerin Ligand) BioAssayTM ELISA Kit (Rat) discontinued
357803-02 96 Tests

OPGL (Osteoprotegerin Ligand) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
SR140 (E-3) Alexa Fluor® 680
sc-398718 AF680 200 µg/mL

SR140 (E-3) Alexa Fluor® 680

Sign In for Pricing
View Details
Nori® Hamster EGF ELISA Kit
GR172139 96 Well

Nori® Hamster EGF ELISA Kit

Sign In for Pricing
View Details
RN5S234 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
39801061 1.0 µg DNA

RN5S234 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details