Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP-binding cassette sub-family C member 8 (ABCC8), partial

This Recombinant Human ATP-binding cassette sub-family C member 8 (ABCC8), partial spans the amino acid sequence from region 320-356. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP-binding cassette sub-family C member 8; Sulfonylurea receptor 1; ABCC8 HRINS SUR SUR1

UniProt

Q09428

Expression Region

320-356

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IFGIVDHLGKENDVFQPKTQFLGVYFVSSQEFLANAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX-11 Antibody (IHC Gold)
E36PA011 100 µL

SOX-11 Antibody (IHC Gold)

Sign In for Pricing
View Details
SRR Antibody
A76532-50UL 50 μL

SRR Antibody

Sign In for Pricing
View Details
Anti-MBD4/MED1 Antibody Picoband® Fluoro594 Conjugated
A03462-Fluoro594 100 µg/Vial

Anti-MBD4/MED1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
GNG10 siRNA (Human)
CRH1861-01 15 nmol

GNG10 siRNA (Human)

Sign In for Pricing
View Details
GNG10 siRNA (Human)
CRH1861-02 30 nmol

GNG10 siRNA (Human)

Sign In for Pricing
View Details
Ethyl 4- (3-bromo-4-chlorophenyl) -6-methyl-2-oxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate
OR1085885-01 250 mg

Ethyl 4- (3-bromo-4-chlorophenyl) -6-methyl-2-oxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate

Sign In for Pricing
View Details