Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pappalysin-1 (PAPP1), partial

This Recombinant Human Pappalysin-1 (PAPP1), partial spans the amino acid sequence from region 1476-1556. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pappalysin-1; EC 3.4.24.79; Insulin-like growth factor-dependent IGF-binding protein 4 protease; IGF-dependent IGFBP-4 protease; IGFBP-4ase; Pregnancy-associated plasma protein A; PAPP-A; PAPPA

UniProt

Q13219

Expression Region

1476-1556

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepsin/HPN Rabbit Polyclonal Antibody (Cy3)
orb2818035 100 µg

Hepsin/HPN Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Neoeriocitrin
BA8464-1 1 mg

Neoeriocitrin

Sign In for Pricing
View Details
NUP88 Antibody Blocking Peptide
orb1515550 500 µg

NUP88 Antibody Blocking Peptide

Sign In for Pricing
View Details
Annexin A13 (ANXA13, ISA, ANX13, Annexin XIII, Annexin-13, Intestine-specific Annexin) (MaxLight 550)
MBS6399543-01 0.1 mL

Annexin A13 (ANXA13, ISA, ANX13, Annexin XIII, Annexin-13, Intestine-specific Annexin) (MaxLight 550)

Sign In for Pricing
View Details
Annexin A13 (ANXA13, ISA, ANX13, Annexin XIII, Annexin-13, Intestine-specific Annexin) (MaxLight 550)
MBS6399543-02 5x 0.1 mL

Annexin A13 (ANXA13, ISA, ANX13, Annexin XIII, Annexin-13, Intestine-specific Annexin) (MaxLight 550)

Sign In for Pricing
View Details
Rat IgM, kappa Isotype Control (PE Conjugated) [RTK2118]
MBS2557678-01 20 Tests

Rat IgM, kappa Isotype Control (PE Conjugated) [RTK2118]

Sign In for Pricing
View Details