Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear mitotic apparatus protein 1 (NUMA1), partial

This Recombinant Human Nuclear mitotic apparatus protein 1 (NUMA1), partial spans the amino acid sequence from region 1-153. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear mitotic apparatus protein 1; Nuclear matrix protein-22; NMP-22; Nuclear mitotic apparatus protein; NuMA protein; SP-H antigen; NUMA1 NMP22 NUMA

UniProt

Q14980

Expression Region

1-153

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSERLDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFEYKIQAELAVILKFVLDHEDGLNLNEDLENFLQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccl26 3'UTR GFP Stable Cell Line
TU153380 1.0 mL

Ccl26 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat RAR Related Orphan Receptor Alpha (RORa RAR) ELISA Kit
YP-W39353-01 48 Tests

Rat RAR Related Orphan Receptor Alpha (RORa RAR) ELISA Kit

Sign In for Pricing
View Details
Rat RAR Related Orphan Receptor Alpha (RORa RAR) ELISA Kit
YP-W39353-02 96 Tests

Rat RAR Related Orphan Receptor Alpha (RORa RAR) ELISA Kit

Sign In for Pricing
View Details
CD200R1 Rabbit Polyclonal Antibody (FITC)
orb2098164 100 µL

CD200R1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant ANXA5 Antibody
RC-4361-01 50 μL

Recombinant ANXA5 Antibody

Sign In for Pricing
View Details
Recombinant ANXA5 Antibody
RC-4361-02 100 µL

Recombinant ANXA5 Antibody

Sign In for Pricing
View Details