Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein MGARP (HUMMR), partial

This Recombinant Human Protein MGARP (HUMMR), partial spans the amino acid sequence from region 1-40. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein MGARP; Corneal endothelium-specific protein 1; CESP-1; Hypoxia up-regulated mitochondrial movement regulator protein; Mitochondria-localized glutamic acid-rich protein; Ovary-specific acidic protein; MGARP C4orf49 CESP1 HUMMR OSAP GS3582

UniProt

Q8TDB4

Expression Region

1-40

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MYLRRAVSKTLALPLRAPPNPAPLGKDASLRRMSSNRFPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MF-438 500mg
A20963-500 500 mg

MF-438 500mg

Sign In for Pricing
View Details
FGGY Rabbit Polyclonal Antibody
E28PN2480 100 µL

FGGY Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Bovine Fibroblast growth factor 1 (FGF1)
orb2658561-01 20 µg

Recombinant Bovine Fibroblast growth factor 1 (FGF1)

Sign In for Pricing
View Details
Recombinant Bovine Fibroblast growth factor 1 (FGF1)
orb2658561-02 100 µg

Recombinant Bovine Fibroblast growth factor 1 (FGF1)

Sign In for Pricing
View Details
Recombinant Bovine Fibroblast growth factor 1 (FGF1)
orb2658561-03 1 mg

Recombinant Bovine Fibroblast growth factor 1 (FGF1)

Sign In for Pricing
View Details
RNMT siRNA (Rat)
MBS8226378-01 15 nmol

RNMT siRNA (Rat)

Sign In for Pricing
View Details