Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bcl-2-binding component 3, isoforms 3/4 (BBC3B)

This Recombinant Human Bcl-2-binding component 3, isoforms 3/4 (BBC3B) spans the amino acid sequence from region 1-261. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bcl-2-binding component 3, isoforms 3/4; JFY-1; p53 up-regulated modulator of apoptosis; BBC3 PUMA

UniProt

Q96PG8

Expression Region

1-261

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GARP/LRRC32 (E2L6B) Rabbit Monoclonal Antibody
CST 83565T 20 µL

GARP/LRRC32 (E2L6B) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human DSG2 (Desmoglein 2) ELISA Kit
EH25205 96 Tests

Human DSG2 (Desmoglein 2) ELISA Kit

Sign In for Pricing
View Details
C-C Motif Chemokine 8 / MCP2 (CCL8) Antibody
abx177584-01 100 µL

C-C Motif Chemokine 8 / MCP2 (CCL8) Antibody

Sign In for Pricing
View Details
C-C Motif Chemokine 8 / MCP2 (CCL8) Antibody
abx177584-02 200 µL

C-C Motif Chemokine 8 / MCP2 (CCL8) Antibody

Sign In for Pricing
View Details
C-C Motif Chemokine 8 / MCP2 (CCL8) Antibody
abx177584-03 1 mL

C-C Motif Chemokine 8 / MCP2 (CCL8) Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Skin
CS646527 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details