Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bcl-2-binding component 3, isoforms 3/4 (BBC3B)

This Recombinant Human Bcl-2-binding component 3, isoforms 3/4 (BBC3B) spans the amino acid sequence from region 1-261. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bcl-2-binding component 3, isoforms 3/4; JFY-1; p53 up-regulated modulator of apoptosis; BBC3 PUMA

UniProt

Q96PG8

Expression Region

1-261

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNPTG Protein Vector (Human) (pPB-C-His)
PV018137 500 ng

GNPTG Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
EHHADH Antibody (FITC)
orb351719-01 50 µg

EHHADH Antibody (FITC)

Sign In for Pricing
View Details
EHHADH Antibody (FITC)
orb351719-02 100 µg

EHHADH Antibody (FITC)

Sign In for Pricing
View Details
Prokaryotic Human Sirtuin 6
RPU60875-01 50 µg

Prokaryotic Human Sirtuin 6

Sign In for Pricing
View Details
Prokaryotic Human Sirtuin 6
RPU60875-02 100 µg

Prokaryotic Human Sirtuin 6

Sign In for Pricing
View Details
Prokaryotic Human Sirtuin 6
RPU60875-03 1 mg

Prokaryotic Human Sirtuin 6

Sign In for Pricing
View Details