Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein S (SELS), partial

This Recombinant Human Selenoprotein S (SELS), partial spans the amino acid sequence from region 49-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein S; SelS; VCP-interacting membrane protein; SELENOS SELS VIMP AD-015 SBBI8

UniProt

Q9BQE4

Expression Region

49-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal ENO3 Antibody (003) [CoraFluor 1]
NBP2-90274CL1 0.1 mL

Rabbit Monoclonal ENO3 Antibody (003) [CoraFluor 1]

Sign In for Pricing
View Details
Zebrafish DLX2A Rabbit Polyclonal Antibody (HRP)
orb2818736 100 µg

Zebrafish DLX2A Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Mouse Rgl1 qPCR Primer Pair
QM20154S 200 Tests

Mouse Rgl1 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse IL-16 Affinity Purified Polyclonal Ab
AF1727-SP 25 µg

Mouse IL-16 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor 1 (TNF-R1) Antibody (ATTO 700)
abx446685 100 µg

Tumor Necrosis Factor Receptor 1 (TNF-R1) Antibody (ATTO 700)

Sign In for Pricing
View Details
ZBTB4 Protein Vector (Human) (pPB-N-His)
PV144263 500 ng

ZBTB4 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details