Recombinant Human Allograft inflammatory factor 1-like (AIF1L)
This Recombinant Human Allograft inflammatory factor 1-like (AIF1L) spans the amino acid sequence from region 2-150. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Allograft inflammatory factor 1-like; Ionized calcium-binding adapter molecule 2; AIF1L C9orf58 IBA2 UNQ672/PRO1306
UniProt
Q9BQI0
Expression Region
2-150
Origin
Homo sapiens (Human)
Field of Research
Musculoskeletal & Connective Tissue Research
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
SGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TG320481 1 Kit
ERK2 (MAPK1) Human shRNA Plasmid Kit (Locus ID 5594)
Sign In for Pricing
View Details