Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 2 (S35B3), partial

This Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 2 (S35B3), partial spans the amino acid sequence from region 1-77. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adenosine 3'-phospho 5'-phosphosulfate transporter 2; 3'-phosphoadenosine 5'-phosphosulfate transporter; PAPS transporter 2; Solute carrier family 35 member B3; SLC35B3 C6orf196 PAPST2 CGI-19

UniProt

Q9H1N7

Expression Region

1-77

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNLSKFNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C109B, CT (CCDC109B, Coiled-coil domain-containing protein 109B) (AP)
MBS6279352-01 0.2 mL

C109B, CT (CCDC109B, Coiled-coil domain-containing protein 109B) (AP)

Sign In for Pricing
View Details
C109B, CT (CCDC109B, Coiled-coil domain-containing protein 109B) (AP)
MBS6279352-02 5x 0.2 mL

C109B, CT (CCDC109B, Coiled-coil domain-containing protein 109B) (AP)

Sign In for Pricing
View Details
SIRP-γ (OX118) : m-IgG Fc BP-HRP Bundle
sc-536891 1 Kit

SIRP-γ (OX118) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Human Ryanodine receptor 1 (RYR1) Elisa Kit
EK713584 96 Well

Human Ryanodine receptor 1 (RYR1) Elisa Kit

Sign In for Pricing
View Details
Sheep Coilin (COIL) ELISA Kit
GTR10361022 96 Well

Sheep Coilin (COIL) ELISA Kit

Sign In for Pricing
View Details
MADM (NRBP1) Mouse Monoclonal Antibody [Clone 2H1]
E45M09107V-2 50 µL

MADM (NRBP1) Mouse Monoclonal Antibody [Clone 2H1]

Sign In for Pricing
View Details