Recombinant Human Protein jagged-2 (JAG2), partial
This Recombinant Human Protein jagged-2 (JAG2), partial spans the amino acid sequence from region 870-944. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Protein jagged-2; Jagged2; hJ2; JAG2
UniProt
Q9Y219
Expression Region
870-944
Origin
Homo sapiens (Human)
Field of Research
Stem Cell & Developmental Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
RSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15153573 1 Vial
Lentiviral human CD3EAP shRNA (UAS) - Lentiviral human CD3EAP shRNA (UAS, GFP) (100)
Sign In for Pricing
View Details