Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium/hydrogen exchanger 8 (SL9A8), partial

This Recombinant Human Sodium/hydrogen exchanger 8 (SL9A8), partial spans the amino acid sequence from region 472-581. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium/hydrogen exchanger 8; Na (+/H (+; exchanger 8; NHE-8; Solute carrier family 9 member 8; SLC9A8 KIAA0939 NHE8

UniProt

Q9Y2E8

Expression Region

472-581

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RLMDIEDAKAHRRNKKDVNLSKTEKMGNTVESEHLSELTEEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit H2S ELISA Kit
ERTH0011 96 Tests

Rabbit H2S ELISA Kit

Sign In for Pricing
View Details
Pigeon Ras-Related Protein Ral-B (RALB) ELISA Kit
MBS9912629 Inquire

Pigeon Ras-Related Protein Ral-B (RALB) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Rab GTPase-activating protein 1-like, isoform 10 (RBG10)
orb3007003-01 20 µg

Recombinant Human Rab GTPase-activating protein 1-like, isoform 10 (RBG10)

Sign In for Pricing
View Details
Recombinant Human Rab GTPase-activating protein 1-like, isoform 10 (RBG10)
orb3007003-02 100 µg

Recombinant Human Rab GTPase-activating protein 1-like, isoform 10 (RBG10)

Sign In for Pricing
View Details
Recombinant Human Rab GTPase-activating protein 1-like, isoform 10 (RBG10)
orb3007003-03 1 mg

Recombinant Human Rab GTPase-activating protein 1-like, isoform 10 (RBG10)

Sign In for Pricing
View Details
PEX5 Recombinant Protein (Mouse)
RP161405 100 µg

PEX5 Recombinant Protein (Mouse)

Sign In for Pricing
View Details