Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium/hydrogen exchanger 8 (SL9A8), partial

This Recombinant Human Sodium/hydrogen exchanger 8 (SL9A8), partial spans the amino acid sequence from region 472-581. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium/hydrogen exchanger 8; Na (+/H (+; exchanger 8; NHE-8; Solute carrier family 9 member 8; SLC9A8 KIAA0939 NHE8

UniProt

Q9Y2E8

Expression Region

472-581

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RLMDIEDAKAHRRNKKDVNLSKTEKMGNTVESEHLSELTEEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxct2b Mouse Gene Knockout Kit (CRISPR)
KN512699 1 Kit

Oxct2b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PGD2-IN-1 100mg
A20451-100 100 mg

PGD2-IN-1 100mg

Sign In for Pricing
View Details
Slfn4 3'UTR Luciferase Stable Cell Line
TU119259 1.0 mL

Slfn4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human peroxisome proliferators activator receptors alpha (PPAR-α) ELISA Kit
QY-E03241 96 Tests

Human peroxisome proliferators activator receptors alpha (PPAR-α) ELISA Kit

Sign In for Pricing
View Details
Monkey Cytoplasmic tRNA 2 thiolation protein 2 (C16orf84) ELISA Kit
GTR10339932 96 Well

Monkey Cytoplasmic tRNA 2 thiolation protein 2 (C16orf84) ELISA Kit

Sign In for Pricing
View Details
PPP1R9A Antibody
MBS8517456-01 0.05 mg

PPP1R9A Antibody

Sign In for Pricing
View Details