Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium/hydrogen exchanger 8 (SL9A8), partial

This Recombinant Human Sodium/hydrogen exchanger 8 (SL9A8), partial spans the amino acid sequence from region 472-581. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium/hydrogen exchanger 8; Na (+/H (+; exchanger 8; NHE-8; Solute carrier family 9 member 8; SLC9A8 KIAA0939 NHE8

UniProt

Q9Y2E8

Expression Region

472-581

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RLMDIEDAKAHRRNKKDVNLSKTEKMGNTVESEHLSELTEEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha-Smooth Muscle Actin Mouse mAb
MBS8538739-01 0.1 mL

alpha-Smooth Muscle Actin Mouse mAb

Sign In for Pricing
View Details
alpha-Smooth Muscle Actin Mouse mAb
MBS8538739-02 0.1 mL (AF405L)

alpha-Smooth Muscle Actin Mouse mAb

Sign In for Pricing
View Details
alpha-Smooth Muscle Actin Mouse mAb
MBS8538739-03 0.1 mL (AF405S)

alpha-Smooth Muscle Actin Mouse mAb

Sign In for Pricing
View Details
alpha-Smooth Muscle Actin Mouse mAb
MBS8538739-04 0.1 mL (AF610)

alpha-Smooth Muscle Actin Mouse mAb

Sign In for Pricing
View Details
alpha-Smooth Muscle Actin Mouse mAb
MBS8538739-05 0.1 mL (AF635)

alpha-Smooth Muscle Actin Mouse mAb

Sign In for Pricing
View Details
alpha-Smooth Muscle Actin Mouse mAb
MBS8538739-06 0.1 mL (APC)

alpha-Smooth Muscle Actin Mouse mAb

Sign In for Pricing
View Details