Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phospholipid-transporting ATPase IF (AT11B), partial

This Recombinant Human Phospholipid-transporting ATPase IF (AT11B), partial spans the amino acid sequence from region 312-341. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phospholipid-transporting ATPase IF; EC 7.6.2.1; ATPase IR; ATPase class VI type 11B; P4-ATPase flippase complex alpha subunit ATP11B; ATP11B ATPIF ATPIR KIAA0956

UniProt

Q9Y2G3

Expression Region

312-341

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAEEKWDEPWYNQKTEHQRNSSKILRFISD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab 9 (G-5) AC
sc-74482 AC 500 µg/mL - 25% ag

Rab 9 (G-5) AC

Sign In for Pricing
View Details
PPPDE2 Protein Vector (Mouse) (pPB-N-His)
PV218823 500 ng

PPPDE2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
RAB3GAP1 Recombinant Protein Antigen
NBP2-38206PEP 0.1 mL

RAB3GAP1 Recombinant Protein Antigen

Sign In for Pricing
View Details
FE65 (APBB1) (NM_001164) Human Over-expression Lysate
E45H19855-2 20 µg

FE65 (APBB1) (NM_001164) Human Over-expression Lysate

Sign In for Pricing
View Details
CLK2 (NM_003993) Human Over-expression Lysate
LS001196-20ug 20 µg

CLK2 (NM_003993) Human Over-expression Lysate

Sign In for Pricing
View Details
Wnt5a Rabbit Polyclonal Antibody
E10G22937 100 µL

Wnt5a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details