Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Syntaxin-binding protein 5-like (STB5L), partial

This Recombinant Human Syntaxin-binding protein 5-like (STB5L), partial spans the amino acid sequence from region 1121-1181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Syntaxin-binding protein 5-like; Lethal (2; giant larvae protein homolog 4; Tomosyn-2; STXBP5L KIAA1006 LLGL4

UniProt

Q9Y2K9

Expression Region

1121-1181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SIEGMKGAAGGVMGELTRARIALDERGQRLGELEEKTAGMMTSAEAFSKHAHELMLKYKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RAB23 qPCR Primer Pair
QH08585S 200 Tests

Human RAB23 qPCR Primer Pair

Sign In for Pricing
View Details
TSPAN32, Control Peptide (Tetraspanin-32, Tspan-32, ART1, Protein Phemx, PHEMX, PHMX, TSSC6, FLJ17158, FLJ97586, MGC22455, TSSC6)
148331 100 µg

TSPAN32, Control Peptide (Tetraspanin-32, Tspan-32, ART1, Protein Phemx, PHEMX, PHMX, TSSC6, FLJ17158, FLJ97586, MGC22455, TSSC6)

Sign In for Pricing
View Details
Recombinant Human Aquaporin-1 (AQP1), partial
MBS948542-01 0.02 mg (E-Coli)

Recombinant Human Aquaporin-1 (AQP1), partial

Sign In for Pricing
View Details
Recombinant Human Aquaporin-1 (AQP1), partial
MBS948542-02 0.1 mg (E-Coli)

Recombinant Human Aquaporin-1 (AQP1), partial

Sign In for Pricing
View Details
Recombinant Human Aquaporin-1 (AQP1), partial
MBS948542-03 1 mg (E-Coli)

Recombinant Human Aquaporin-1 (AQP1), partial

Sign In for Pricing
View Details
Recombinant Human Aquaporin-1 (AQP1), partial
MBS948542-04 5x 1 mg (E-Coli)

Recombinant Human Aquaporin-1 (AQP1), partial

Sign In for Pricing
View Details